From: gb-admin@ncbi.nlm.nih.gov
Sent: Tuesday, May 07, 2002 11:54 AM
To: Lin, Peter
Subject: [NCBI_REF 1200852] GenBank AF503775

Dear GenBank Submitter:

Thank you for your submission.

Based on the data submitted to us, the scheduled release date
for your submission is:

		May 12 2002 
If this date is not correct, please get in touch with us as soon as
possible (gb-admin@ncbi.nlm.nih.gov, telephone at (301) 496-2475, or
fax at (301) 480-2918), otherwise this submission will be released
on the date indicated above.  The data would then be available over
the network data servers which provide daily updates of GenBank data.
The data are simultaneously made available to EMBL in Europe and the
DNA Data Bank of Japan.

Minor changes may have been made in your original submission in order to
conform to database annotation conventions.  You can greatly assist us in
presenting your data in as accurate a manner as possible by paying specific
attention to the following in your review:

        -  Spelling (particularly author names)
        -  Citation data (author order, page span, etc.)
        -  Nomenclature ('official' gene names, product labels, etc.)
        -  Taxonomic and source data
        -  Feature spans and descriptions (particularly non-coding regions)

Please send any revisions, including bibliographic information (e.g.,
conversion from unpublished to published), biological data  (e.g., new
features), or sequence data as text in the body of an email to:

        gb-admin@ncbi.nlm.nih.gov

Since the flatfile record is a display format only and is not an editable
format of the data, do not make changes directly to a flatfile.  In
addition, please do not use bold, highlighted, or colored edits and
do not use attached files or spreadsheets for additional or revised data. 

An accession number has been assigned to each sequence and was provided
to you at the time receipt of your submission was acknowledged.  We strongly
recommend that this number appear in any publication which reports or
discusses these data, as it gives the community a convenient label with
which they may retrieve your data from our on-line servers.

Thank you once again for your submission.

Sincerely,

Rich McVeigh Ph.D.
GenBank Direct Submission Staff
gb-admin@ncbi.nlm.nih.gov


GenBank flat file:

LOCUS       AF503775                 280 bp    mRNA    linear   VRT 12-MAY-2002
DEFINITION  Fundulus heteroclitus activin/inhibin beta B subunit mRNA, partial
            cds.
ACCESSION   AF503775
KEYWORDS    .
SOURCE      killifish.
  ORGANISM  Fundulus heteroclitus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;
            Acanthomorpha; Acanthopterygii; Percomorpha; Atherinomorpha;
            Cyprinodontiformes; Fundulidae; Fundulus.
REFERENCE   1  (bases 1 to 280)
  AUTHORS   Lin,Y.-W.P. and Petrino,T.R.
  TITLE     Cloning and sequencing of Fundulus heteroclitus activin/inhibin
            beta B subunit
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 280)
  AUTHORS   Lin,Y.-W.P. and Petrino,T.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-APR-2002) School of Natural and Health Sciences,
            Barry University, 11300 NE Second Ave., Miami Shores, FL
            33161-6695, USA
FEATURES             Location/Qualifiers
     source          1..280
                     /organism="Fundulus heteroclitus"
                     /db_xref="taxon:8078"
     CDS             <1..>280
                     /codon_start=3
                     /product="activin/inhibin beta B subunit"
                     /translation="CCRQQFYIDFRLIGWNDWIIAPSGYFGNYCEGNCPAYMAGVPGS
                     ASSFHTAVVNQYRMRGMSPGSMNSCCIPTKLSTMSMLYFDDEYNIVKR"
BASE COUNT       54 a     98 c     75 g     53 t
ORIGIN      
        1 tgtgctgccg gcaacagttc tacatcgact tccggctcat cggctggaac gactggatca
       61 tcgcgccgtc aggctacttc gggaactact gcgagggcaa ctgcccggcc tacatggcgg
      121 gcgtccccgg ctcggcctcg tccttccaca cggcggtggt gaaccagtac cgcatgcggg
      181 gcatgagccc cggctccatg aactcctgct gcatccccac caagctcagc accatgtcca
      241 tgctctactt cgacgacgag tacaacatcg tcaaacgtga 
//