From: gb-admin@ncbi.nlm.nih.gov Sent: Thursday, August 11, 2005 10:14 AM To: Lin, Peter Subject: GenBank AY836522 Dear Dr. Lin: Thank you for your recent reply: >This is to confirm that DQ140181 is an update to AY836522, and DQ140181 >has not been used in a publication. You can retire DQ140181 from the >database and update AY836522 with the new sequence data. We have processed the update you have requested for AY836522, which is appended for your inspection. Your revised record should become available from our different servers within a few days. If you want more information about these, our service desk can help you with this. They can be reached by email at: info@ncbi.nlm.nih.gov, or by phone at: 301-496-2475. We have deleted DQ140181 from our database. Please note that this accession number has been retired and, since it has not been used for any publication and has not been made public, it will no longer be valid for any searches in the database. If you have additional information about your sequences or wish to make further revisions, please inform us. Revisions may pertain to the bibliography, to the biological data (e.g., new features), or to the sequence data. Please send additional revisions to: gb-admin@ncbi.nlm.nih.gov Since the flatfile record is a display format only and is not an editable format of the data, do not make changes directly to a flatfile. In addition, please do not use bold, highlighted, or colored edits, or spreadsheets for additional or revised data. Thank you for your update notification. Sincerely, Anjanette Johnston, PhD The GenBank Submissions Staff Bethesda, Maryland USA ******************************************************************* (301) 496-2475 (301) 480-2918 fax gb-admin@ncbi.nlm.nih.gov (for replies/updates to records in GenBank) info@ncbi.nlm.nih.gov (for general questions regarding GenBank) ******************************************************************* revised GenBank flatfile: LOCUS AY836522 1477 bp mRNA linear VRT 11-AUG-2005 DEFINITION Fundulus heteroclitus inhibin alpha subunit mRNA, complete cds. ACCESSION AY836522 VERSION AY836522.2 GI:72256201 KEYWORDS . SOURCE Fundulus heteroclitus (killifish) ORGANISM Fundulus heteroclitus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei; Acanthomorpha; Acanthopterygii; Percomorpha; Atherinomorpha; Cyprinodontiformes; Fundulidae; Fundulus. REFERENCE 1 (bases 1 to 1477) AUTHORS Petrino,T.R., Toussaint,G. and Lin,Y.-W.P. TITLE Cloning and sequencing of Fundulus heteroclitus inhibin alpha subunit JOURNAL Unpublished REFERENCE 2 (bases 1 to 1477) AUTHORS Petrino,T.R., Toussaint,G. and Lin,Y.-W.P. TITLE Direct Submission JOURNAL Submitted (23-NOV-2004) School of Natural & Health Sciences, Barry University, 11300 NE Second Ave., Miami Shores, FL 33161-6695, USA REFERENCE 3 (bases 1 to 1477) AUTHORS Petrino,T.R., Toussaint,G. and Lin,Y.-W.P. TITLE Direct Submission JOURNAL Submitted (21-JUL-2005) School of Natural & Health Sciences, Barry University, 11300 NE Second Ave., Miami Shores, FL 33161-6695, USA REMARK Sequence update by submitter FEATURES Location/Qualifiers source 1..1477 /organism="Fundulus heteroclitus" /mol_type="mRNA" /db_xref="taxon:8078" CDS 45..1085 /note="gonadal protein; transforming growth factor" /codon_start=1 /product="inhibin alpha subunit" /protein_id="AAW02847.2" /db_xref="GI:72256202" /translation="MVSCALLVLGPLWIQSMLQVCKTEKLPRGVVVSWFRERVLDGLG LLEPPLIEQRPNRERAKPETRHRQPRVPRTSRAVRVSHQTSPDQDISEIILFPIPDSP CATADTEMRENSSSTLSYHFQPSTVFQKTVVTSAHFWFYAGGLLNSSSSLFILTSAQQ RLQAAQAPPTFSSDGWTTYALDQSVLGPVAEGPFRLQIQGSSCQHHIKNPDEMPFLHL HARPRAPIRSRREAPVTIPWSPSAIPLLQRPSHERPQHNDCHREQVEISFQELGWDSW IVHPKVFSFYYCHGNCSARDRTATLLGIAQCCAPVPGTMRPMRITTTSDGGYSFKYET LPNIIPVECSCF" BASE COUNT 373 a 376 c 365 g 362 t 1 others ORIGIN 1 gggggatagg gggcaattcc taggaattgt aacatggtgg agtcatggtg tcctgtgctc 61 tccttgtcct gggccctctc tggatccaaa gtatgcttca ggtctgcaag actgaaaagc 121 tgcccagagg ggttgtggtg tcctggttca gggaacgggt tctggatggc ctggggctac 181 tagagcctcc tttaattgaa cagagaccaa atcgggaaag agcaaaacca gagacgaggc 241 accggcaacc gagggtccct aggactagca gagcggtgcg ggtcagtcat caaaccagtc 301 cggaccagga tatatcagaa attattctgt ttcccattcc agattcaccc tgtgccacgg 361 ctgacacaga aatgagagaa aactccagca gcaccttgtc ataccacttc cagccctcca 421 ctgtgttcca gaaaacggtg gtcacctctg ctcacttctg gttctacgct gggggactac 481 tgaacagctc gtcctcgctt ttcattctca cctcagcaca gcagcgtctt caggctgcgc 541 aggctccgcc gacgttcagc tcagatggat ggaccaccta tgccctggat caaagtgtgc 601 tgggccctgt cgccgagggc ccttttcggc ttcagatcca gggttcatct tgtcagcacc 661 acattaagaa tcccgatgag atgccttttc ttcacctcca tgctcggccc agagcaccta 721 ttcgttcccg tagagaggcc cctgtcacca tcccttggtc tccctctgcc atccccctcc 781 tccagcggcc ctcacacgag aggccccagc acaacgactg ccacagggag caggttgaga 841 tcagcttcca ggagctgggc tgggacagct ggatcgtcca tccaaaagtt ttttctttct 901 actactgcca cgggaactgc tcagccaggg accggaccgc caccctgttg gggattgctc 961 agtgctgcgc tccagttcct gggaccatga ggcccatgag gatcaccacc acatctgatg 1021 gcgggtactc gttcaaatat gagaccctgc ccaacatcat acctgtggag tgcagctgtt 1081 tttgaacatg acagacaagg atgtgttgag aaatgctaag aagggggggg ggggctaaac 1141 cccaggaggt tagatttaaa atctaaataa aatatctatt aacgctgttg ttataaaagg 1201 ctggaaaagt ttgactatga agtacagtaa atcaattaaa ataagtagcg gtactgcaaa 1261 ctgaaaattc aaggttttta tactttgtta ctggacatct tacttaaaat agaaaccaat 1321 aagctcctgc cacggtttgg cttctctcta agtgtgatgc atttggtctc gcagtaaaga 1381 gttatttcag aacggttttg aaatctggag tatcttagat tgtctgtttc aaagtgtatt 1441 aaaagttaaa catgtgtcnt ctgaaaaaaa aaaaaaa //