LOCUS NM_002191 1424 bp mRNA PRI 31-OCT-2000
DEFINITION Homo sapiens inhibin, alpha (INHA), mRNA.
ACCESSION NM_002191
VERSION NM_002191.2 GI:9257223
KEYWORDS .
SOURCE human.
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1424)
AUTHORS Mason,A.J., Niall,H.D. and Seeburg,P.H.
TITLE Structure of two human ovarian inhibins
JOURNAL Biochem. Biophys. Res. Commun. 135 (3), 957-964 (1986)
MEDLINE 86186863
PUBMED 3754442
REFERENCE 2 (bases 1 to 1424)
AUTHORS Mayo,K.E., Cerelli,G.M., Spiess,J., Rivier,J., Rosenfeld,M.G.,
Evans,R.M. and Vale,W.
TITLE Inhibin A-subunit cDNAs from porcine ovary and human placenta
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 83 (16), 5849-5853 (1986)
MEDLINE 86287350
REFERENCE 3 (bases 1 to 1424)
AUTHORS Stewart AG, Milborrow HM, Ring JM, Crowther CE and Forage RG.
TITLE Human inhibin genes. Genomic characterisation and sequencing
JOURNAL FEBS Lett. 206 (2), 329-334 (1986)
MEDLINE 87005283
PUBMED 3758355
REFERENCE 4 (bases 1 to 1424)
AUTHORS Burger,H.G. and Igarashi,M.
TITLE Inhibin: definition and nomenclature, including related substances
JOURNAL Endocrinology 122 (4), 1701-1702 (1988)
MEDLINE 88151816
PUBMED 3345731
REFERENCE 5 (bases 1 to 1424)
AUTHORS Lappohn,R.E., Burger,H.G., Bouma,J., Bangah,M., Krans,M. and de
Bruijn,H.W.
TITLE Inhibin as a marker for granulosa-cell tumors
JOURNAL N. Engl. J. Med. 321 (12), 790-793 (1989)
MEDLINE 89365051
PUBMED 2770810
REFERENCE 6 (bases 1 to 1424)
AUTHORS Matzuk,M.M., Finegold,M.J., Su,J.G., Hsueh,A.J. and Bradley,A.
TITLE Alpha-inhibin is a tumour-suppressor gene with gonadal specificity
in mice
JOURNAL Nature 360 (6402), 313-319 (1992)
MEDLINE 93078845
PUBMED 1448148
REFERENCE 7 (bases 1 to 1424)
AUTHORS Mellor,S.L., Richards,M.G., Pedersen,J.S., Robertson,D.M. and
Risbridger,G.P.
TITLE Loss of the expression and localization of inhibin alpha-subunit in
high grade prostate cancer
JOURNAL J. Clin. Endocrinol. Metab. 83 (3), 969-975 (1998)
MEDLINE 98165602
PUBMED 9506758
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from M13981.1, M13144.1.
On Jul 18, 2000 this sequence version replaced gi:4504696.
Summary: The inhibin alpha subunit joins either the beta A or beta
B subunit to form a pituitary FSH secretion inhibitor. Inhibin has
been shown to regulate gonadal stromal cell proliferation
negatively and to have tumour-suppressor activity. In addition,
serum levels of inhibin have been shown to reflect the size of
granulosa-cell tumors and can therefore be used as a marker for
primary as well as recurrent disease. However, in prostate cancer,
expression of the inhibin alpha-subunit gene was suppressed and was
not detectable in poorly differentiated tumor cells. Furthermore,
because expression in gonadal and various extragonadal tissues may
vary severalfold in a tissue-specific fashion, it is proposed that
inhibin may be both a growth/differentiation factor and a hormone.
FEATURES Location/Qualifiers
source 1..1424
/organism="Homo sapiens"
/db_xref="taxon:9606"
/chromosome="2"
/map="2q33-q36"
gene 1..1424
/gene="INHA"
/db_xref="LocusID:3623"
/db_xref="MIM:147380"
CDS 145..1245
/gene="INHA"
/note="A-inhibin subunit precursor"
/codon_start=1
/db_xref="LocusID:3623"
/db_xref="MIM:147380"
/product="inhibin alpha subunit precursor"
/protein_id="NP_002182.1"
/db_xref="GI:4504697"
/translation="MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPP
AVTREGGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGL
AQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPG
GPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAH
TRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGW
ERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGT
MRPLHVRTTSDGGYSFKYETVPNLLTQHCACI"
sig_peptide 145..198
misc_feature 199..1242
/note="encodes inhibin alpha proprotein"
mat_peptide 841..1242
/product="inhibin alpha subunit"
misc_feature 928..1239
/note="TGFB; Region: Transforming growth factor-beta
(TGF-beta) family"
misc_feature 928..1239
/note="TGF-beta; Region: Transforming growth factor beta
like domain"
BASE COUNT 250 a 469 c 425 g 280 t
ORIGIN
1 gaaggactgg ggaagactgg atgagaaggg tagaagaggg tgggtgtggg atggggaggg
61 gagagtggaa aggccctggg cagaccctgg cagaaggggc acggggcagg gtgtgagttc
121 cccactagca gggccaggtg agctatggtg ctgcacctac tgctcttctt gctgctgacc
181 ccacagggtg ggcacagctg ccaggggctg gagctggccc gggaacttgt tctggccaag
241 gtgagggccc tgttcttgga tgccttgggg ccccccgcgg tgaccaggga aggtggggac
301 cctggagtca ggcggctgcc ccgaagacat gccctggggg gcttcacaca caggggctct
361 gagcccgagg aagaggagga tgtctcccaa gccatccttt tcccagccac agatgccagc
421 tgtgaggaca agtcagctgc cagagggctg gcccaggagg ctgaggaggg cctcttcaga
481 tacatgttcc ggccatccca gcatacacgc agccgccagg tgacttcagc ccagctgtgg
541 ttccacaccg ggctggacag gcagggcaca gcagcctcca atagctctga gcccctgcta
601 ggcctgctgg cactgtcacc gggaggaccc gtggctgtgc ccatgtcttt gggccatgct
661 ccccctcact gggccgtgct gcacctggcc acctctgctc tctctctgct gacccacccc
721 gtcctggtgc tgctgctgcg ctgtcccctc tgtacctgct cagcccggcc tgaggccacg
781 cccttcctgg tggcccacac tcggaccaga ccacccagtg gaggggagag agcccgacgc
841 tcaactcccc tgatgtcctg gccttggtct ccctctgctc tgcgcctgct gcagaggcct
901 ccggaggaac cggctgccca tgccaactgc cacagagtag cactgaacat ctccttccag
961 gagctgggct gggaacggtg gatcgtgtac cctcccagtt tcatcttcca ctactgtcat
1021 ggtggttgtg ggctgcacat cccaccaaac ctgtcccttc cagtccctgg ggctccccct
1081 accccagccc agccctactc cttgctgcca ggggcccagc cctgctgtgc tgctctccca
1141 gggaccatga ggcccctaca tgtccgcacc acctcggatg gaggttactc tttcaagtat
1201 gagacagtgc ccaaccttct cacgcagcac tgtgcttgta tctaagggtg gggggtcttc
1261 cttcttaatc ccatggctgg tggccacgcc cccaccatca tcagctggga ggaaaggcag
1321 agttgggaaa tagatggctc ccactcctcc ctcctttcac ttctctgcct atgggctacc
1381 ctccccaccc cacttctatc tcaataaaga acacagtgca tatg
//
